Back to Multiple platform build/check report for BioC 3.22: simplified long |
|
This page was generated on 2025-10-11 12:04 -0400 (Sat, 11 Oct 2025).
Hostname | OS | Arch (*) | R version | Installed pkgs |
---|---|---|---|---|
nebbiolo2 | Linux (Ubuntu 24.04.3 LTS) | x86_64 | 4.5.1 Patched (2025-08-23 r88802) -- "Great Square Root" | 4864 |
lconway | macOS 12.7.1 Monterey | x86_64 | 4.5.1 Patched (2025-09-10 r88807) -- "Great Square Root" | 4652 |
kjohnson3 | macOS 13.7.7 Ventura | arm64 | 4.5.1 Patched (2025-09-10 r88807) -- "Great Square Root" | 4597 |
taishan | Linux (openEuler 24.03 LTS) | aarch64 | 4.5.0 (2025-04-11) -- "How About a Twenty-Six" | 4586 |
Click on any hostname to see more info about the system (e.g. compilers) (*) as reported by 'uname -p', except on Windows and Mac OS X |
Package 1045/2346 | Hostname | OS / Arch | INSTALL | BUILD | CHECK | BUILD BIN | ||||||||
immunogenViewer 1.3.1 (landing page) Katharina Waury
| nebbiolo2 | Linux (Ubuntu 24.04.3 LTS) / x86_64 | OK | OK | OK | ![]() | ||||||||
lconway | macOS 12.7.1 Monterey / x86_64 | OK | OK | OK | OK | ![]() | ||||||||
kjohnson3 | macOS 13.7.7 Ventura / arm64 | OK | OK | OK | OK | ![]() | ||||||||
taishan | Linux (openEuler 24.03 LTS) / aarch64 | OK | OK | OK | ||||||||||
To the developers/maintainers of the immunogenViewer package: - Allow up to 24 hours (and sometimes 48 hours) for your latest push to git@git.bioconductor.org:packages/immunogenViewer.git to reflect on this report. See Troubleshooting Build Report for more information. - Use the following Renviron settings to reproduce errors and warnings. - If 'R CMD check' started to fail recently on the Linux builder(s) over a missing dependency, add the missing dependency to 'Suggests:' in your DESCRIPTION file. See Renviron.bioc for more information. |
Package: immunogenViewer |
Version: 1.3.1 |
Command: /Library/Frameworks/R.framework/Resources/bin/R CMD check --install=check:immunogenViewer.install-out.txt --library=/Library/Frameworks/R.framework/Resources/library --no-vignettes --timings immunogenViewer_1.3.1.tar.gz |
StartedAt: 2025-10-10 22:40:08 -0400 (Fri, 10 Oct 2025) |
EndedAt: 2025-10-10 22:43:02 -0400 (Fri, 10 Oct 2025) |
EllapsedTime: 173.9 seconds |
RetCode: 0 |
Status: OK |
CheckDir: immunogenViewer.Rcheck |
Warnings: 0 |
############################################################################## ############################################################################## ### ### Running command: ### ### /Library/Frameworks/R.framework/Resources/bin/R CMD check --install=check:immunogenViewer.install-out.txt --library=/Library/Frameworks/R.framework/Resources/library --no-vignettes --timings immunogenViewer_1.3.1.tar.gz ### ############################################################################## ############################################################################## * using log directory ‘/Users/biocbuild/bbs-3.22-bioc/meat/immunogenViewer.Rcheck’ * using R version 4.5.1 Patched (2025-09-10 r88807) * using platform: x86_64-apple-darwin20 * R was compiled by Apple clang version 14.0.0 (clang-1400.0.29.202) GNU Fortran (GCC) 14.2.0 * running under: macOS Monterey 12.7.6 * using session charset: UTF-8 * using option ‘--no-vignettes’ * checking for file ‘immunogenViewer/DESCRIPTION’ ... OK * checking extension type ... Package * this is package ‘immunogenViewer’ version ‘1.3.1’ * package encoding: UTF-8 * checking package namespace information ... OK * checking package dependencies ... OK * checking if this is a source package ... OK * checking if there is a namespace ... OK * checking for hidden files and directories ... OK * checking for portable file names ... OK * checking for sufficient/correct file permissions ... OK * checking whether package ‘immunogenViewer’ can be installed ... OK * checking installed package size ... OK * checking package directory ... OK * checking ‘build’ directory ... OK * checking DESCRIPTION meta-information ... OK * checking top-level files ... OK * checking for left-over files ... OK * checking index information ... OK * checking package subdirectories ... OK * checking code files for non-ASCII characters ... OK * checking R files for syntax errors ... OK * checking whether the package can be loaded ... OK * checking whether the package can be loaded with stated dependencies ... OK * checking whether the package can be unloaded cleanly ... OK * checking whether the namespace can be loaded with stated dependencies ... OK * checking whether the namespace can be unloaded cleanly ... OK * checking dependencies in R code ... NOTE Namespaces in Imports field not imported from: ‘httr’ ‘jsonlite’ All declared Imports should be used. * checking S3 generic/method consistency ... OK * checking replacement functions ... OK * checking foreign function calls ... OK * checking R code for possible problems ... NOTE addImmunogensToPlot: no visible binding for global variable ‘xmin’ addImmunogensToPlot: no visible binding for global variable ‘xmax’ addImmunogensToPlot: no visible binding for global variable ‘ymin’ addImmunogensToPlot: no visible binding for global variable ‘ymax’ addImmunogensToPlot: no visible binding for global variable ‘x’ addImmunogensToPlot: no visible binding for global variable ‘y’ addImmunogensToPlot: no visible binding for global variable ‘label’ plotAccessibility: no visible binding for global variable ‘SolventAccessibility’ plotSecondaryStructure: no visible binding for global variable ‘SecondaryStructure’ plotSinglePositions: no visible binding for global variable ‘Location’ plotSinglePositions: no visible binding for global variable ‘y’ Undefined global functions or variables: Location SecondaryStructure SolventAccessibility label x xmax xmin y ymax ymin * checking Rd files ... OK * checking Rd metadata ... OK * checking Rd cross-references ... OK * checking for missing documentation entries ... OK * checking for code/documentation mismatches ... OK * checking Rd \usage sections ... OK * checking Rd contents ... OK * checking for unstated dependencies in examples ... OK * checking files in ‘vignettes’ ... OK * checking examples ... OK * checking for unstated dependencies in ‘tests’ ... OK * checking tests ... Running ‘testthat.R’ OK * checking for unstated dependencies in vignettes ... OK * checking package vignettes ... OK * checking running R code from vignettes ... SKIPPED * checking re-building of vignette outputs ... SKIPPED * checking PDF version of manual ... OK * DONE Status: 2 NOTEs See ‘/Users/biocbuild/bbs-3.22-bioc/meat/immunogenViewer.Rcheck/00check.log’ for details.
immunogenViewer.Rcheck/00install.out
############################################################################## ############################################################################## ### ### Running command: ### ### /Library/Frameworks/R.framework/Resources/bin/R CMD INSTALL immunogenViewer ### ############################################################################## ############################################################################## * installing to library ‘/Library/Frameworks/R.framework/Versions/4.5-x86_64/Resources/library’ * installing *source* package ‘immunogenViewer’ ... ** this is package ‘immunogenViewer’ version ‘1.3.1’ ** using staged installation ** R ** inst ** byte-compile and prepare package for lazy loading ** help *** installing help indices ** building package indices ** installing vignettes ** testing if installed package can be loaded from temporary location ** testing if installed package can be loaded from final location ** testing if installed package keeps a record of temporary installation path * DONE (immunogenViewer)
immunogenViewer.Rcheck/tests/testthat.Rout
R version 4.5.1 Patched (2025-09-10 r88807) -- "Great Square Root" Copyright (C) 2025 The R Foundation for Statistical Computing Platform: x86_64-apple-darwin20 R is free software and comes with ABSOLUTELY NO WARRANTY. You are welcome to redistribute it under certain conditions. Type 'license()' or 'licence()' for distribution details. R is a collaborative project with many contributors. Type 'contributors()' for more information and 'citation()' on how to cite R or R packages in publications. Type 'demo()' for some demos, 'help()' for on-line help, or 'help.start()' for an HTML browser interface to help. Type 'q()' to quit R. > # This file is part of the standard setup for testthat. > # It is recommended that you do not modify it. > # > # Where should you do additional test configuration? > # Learn more about the roles of various files in: > # * https://r-pkgs.org/testing-design.html#sec-tests-files-overview > # * https://testthat.r-lib.org/articles/special-files.html > > library(testthat) > library(immunogenViewer) > > test_check("immunogenViewer") [1] "Immunogen name: A12" [1] "Immunogen sequence: GHLFAINYTGASMNPARSFGPAVIMGNWENH (Residues 200 - 230)" [1] "No immunogen specified, evaluating all immunogens." [1] "Immunogen name: A12" [1] "Immunogen sequence: GHLFAINYTGASMNPARSFGPAVIMGNWENH (Residues 200 - 230)" [ FAIL 0 | WARN 0 | SKIP 0 | PASS 39 ] > > proc.time() user system elapsed 11.785 0.630 30.251
immunogenViewer.Rcheck/immunogenViewer-Ex.timings
name | user | system | elapsed | |
addImmunogen | 0.121 | 0.011 | 1.058 | |
addImmunogenList | 0.077 | 0.004 | 2.005 | |
evaluateImmunogen | 0.093 | 0.005 | 2.042 | |
getProteinFeatures | 0.089 | 0.018 | 1.953 | |
plotImmunogen | 1.144 | 0.017 | 2.995 | |
plotProtein | 1.627 | 0.014 | 2.581 | |
removeImmunogen | 0.084 | 0.003 | 1.361 | |
renameImmunogen | 0.093 | 0.003 | 2.008 | |